PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0129s0210.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 359aa    MW: 41342.2 Da    PI: 6.5629
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0129s0210.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.25.5e-5671361129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPtdeelv++yL+kkv+++++++ +vik+vd+yk+ePwdL++  ++ + e++ewyfFs++dkky+tg+r+nrat++g+Wk
  SapurV1A.0129s0210.4.p   7 VPPGFRFHPTDEELVDYYLRKKVNARRIDV-DVIKDVDLYKIEPWDLQElcRIGTdEQTEWYFFSHKDKKYPTGTRTNRATAAGFWK 92 
                             69****************************.9***************954555552555**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             atg+dk+++s k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  SapurV1A.0129s0210.4.p  93 ATGRDKAIYS-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                             **********.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-605156IPR003441NAC domain
PROSITE profilePS5100559.8737156IPR003441NAC domain
PfamPF023656.8E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MNTFTHVPPG FRFHPTDEEL VDYYLRKKVN ARRIDVDVIK DVDLYKIEPW DLQELCRIGT  60
DEQTEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GAPQEEGWVV CRVFKKRLPT MRKVSEHESV CWYDDQVAFL  180
HDLDSPKQNS QPDLGFQFPY PCKKEIDLQY QIPHDHFLQL PLLQSPKLLQ SAPTITCNSI  240
NAGYGLDINQ ASTIQSSTLT QEDHIQHANG QSFPSIYGNN NINEQAFDQV TDWRVLDKFV  300
ASQLSQDDVV KENSHQNASS HIFNTSSVHL VRHLNKQDTS VPENASTSTS SCQIDLWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50615714169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999370.0AB599937.1 Populus trichocarpa PtVNS06 mRNA for transcription factor, complete cds.
GenBankHQ2158520.0HQ215852.1 Populus trichocarpa wood-associated NAC domain transcription factor 3B (WND3B) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011029951.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-141NAC7_ARATH; NAC domain-containing protein 7
TrEMBLF1T1110.0F1T111_POPTR; Transcription factor
STRINGPOPTR_0012s14660.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-118NAC 007